}, "context" : "envParam:quiltName,message,product,contextId,contextUrl", ] "disableKudosForAnonUser" : "false", // -->. "event" : "QuickReply", { }, VPN Client Subnet: 192.168.10.0/24----- I have already connected to VPN Client on Meraki from the internet. ] "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } { }, Users can upload and download files, mount network drives, and access resources as if they were on the local network. LITHIUM.AjaxSupport.ComponentEvents.set({ ] } } "context" : "envParam:entity", "action" : "rerender" "selector" : "#kudosButtonV2_0", "context" : "", "action" : "rerender" "event" : "QuickReply", "action" : "rerender" "action" : "rerender" ] } }, }, ] } { }, "event" : "MessagesWidgetAnswerForm", "context" : "lia-deleted-state", { ] }, "action" : "rerender" ] }, "action" : "rerender" ] "disableLabelLinks" : "false", "action" : "rerender" }, "context" : "", { "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); ] "context" : "envParam:quiltName,product,contextId,contextUrl", Under the VPN Access Tab, Ensure that WAN Remote Access Networks is a part of the group, as this tells the SonicWall that the VPN client has access to the Internet. ] { "event" : "MessagesWidgetEditAnswerForm", ] ] ] "event" : "editProductMessage", "actions" : [ "action" : "addClassName" "actions" : [ { "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "floatedBlock" : "acceptedSolutions", ] "initiatorBinding" : true, "event" : "unapproveMessage", ] ] ] "context" : "envParam:quiltName", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); "actions" : [ "context" : "", } "parameters" : { "actions" : [ } "linkDisabled" : "false" { { "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "actions" : [ "context" : "", "context" : "envParam:feedbackData", "disableKudosForAnonUser" : "false", "action" : "pulsate" LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } "action" : "rerender" { "selector" : "#messageview", }, }, } "actions" : [ "actions" : [ } "context" : "envParam:selectedMessage", "disableLabelLinks" : "false", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } "initiatorBinding" : true, "eventActions" : [ "disableLinks" : "false", "useSubjectIcons" : "true", }); } } "initiatorBinding" : true, "actions" : [ } "action" : "rerender" "action" : "rerender" opening Outlook). "action" : "rerender" { ] }, "action" : "rerender" }, "initiatorDataMatcher" : "data-lia-message-uid" }, "event" : "markAsSpamWithoutRedirect", "truncateBody" : "true", }, { ] } "useCountToKudo" : "false", ] "context" : "lia-deleted-state", "displaySubject" : "true", So, I don't need to disable the firewall? "action" : "rerender" { "actions" : [ "action" : "rerender" ] { "event" : "RevokeSolutionAction", ] "useSimpleView" : "false", } }, "actions" : [ { "linkDisabled" : "false" "event" : "markAsSpamWithoutRedirect", "context" : "", "context" : "envParam:feedbackData", "actions" : [ { "action" : "rerender" }, }, "action" : "rerender" } { ] { }, "actions" : [ When try to access local resources either mapped or using \\LAN_Resource\sharename users are either prompted for a username and password or LAN Resource is unable to be located. "actions" : [ The user name and password are correct, and I can connect with the Android app. "actions" : [ { "action" : "rerender" }, "event" : "QuickReply", "event" : "unapproveMessage", } } LITHIUM.Components.renderInPlace('recommendations.widget.recommended-content-taplet', {"componentParams":"{\n \"mode\" : \"slim\",\n \"componentId\" : \"recommendations.widget.recommended-content-taplet\"\n}","componentId":"recommendations.widget.recommended-content-taplet"}, {"errorMessage":"An Unexpected Error has occurred. I have already connected to VPN Client on Meraki from the internet. { }, { ] "useSubjectIcons" : "true", "actions" : [ ] "action" : "rerender" "event" : "ProductAnswer", Double click Internet Protocol Version 4 (TCP / IPv4). "action" : "rerender" { { { }, }, LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '1bENveiVZ1yOgLpuInRL6U_-IVyhOtkTGhuVjLD4SB8. "actions" : [ { "event" : "removeMessageUserEmailSubscription", "event" : "markAsSpamWithoutRedirect", { "initiatorBinding" : true, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_4","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_4","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"vVLj-5BNNRqE_nHcDZ7SSvKZOAqxn4900r8u6wE-T5A. "context" : "envParam:selectedMessage", ] "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "actions" : [ "context" : "envParam:quiltName,expandedQuiltName", "useCountToKudo" : "false", { ] "action" : "rerender" "event" : "addMessageUserEmailSubscription", "entity" : "33336", "actions" : [ Launch the Settings app and navigate to Network & Internet |VPN. }, "useTruncatedSubject" : "true", { "event" : "removeMessageUserEmailSubscription", "eventActions" : [ }, { "actions" : [ "eventActions" : [ { "includeRepliesModerationState" : "false", ] { "entity" : "33336", "eventActions" : [ "messageViewOptions" : "1111110111111111111110111110100101001101" }); "disallowZeroCount" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_3","feedbackSelector":".InfoMessage"}); }, "selector" : "#messageview_4", ], "actions" : [ "event" : "RevokeSolutionAction", "initiatorDataMatcher" : "data-lia-message-uid" }, { } ] The issue is that when connected to the VPN the users cannot access drives mapped to DFS shares. "event" : "editProductMessage", { "actions" : [ "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { "displayStyle" : "horizontal", }, "context" : "", "action" : "rerender" } } "actions" : [ "event" : "MessagesWidgetMessageEdit", "actions" : [ } LITHIUM.MessageBodyDisplay('#bodyDisplay_4', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "selector" : "#kudosButtonV2", } ] } "event" : "kudoEntity", "entity" : "33328", { } }, } }, } However, this scenario is ideal. } { { }, "disallowZeroCount" : "false", "actions" : [ "eventActions" : [ "context" : "", "context" : "", ] ] } "context" : "", "action" : "rerender" "event" : "unapproveMessage", ] "actions" : [ { LITHIUM.AjaxSupport.fromLink('#enableAutoComplete', 'enableAutoComplete', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'evkVRykALMgKG-KAmQf75ao_Zh_3mk5ZMR3cP671JmQ. ] { "context" : "envParam:quiltName,message", "action" : "rerender" "context" : "lia-deleted-state", "selector" : "#kudosButtonV2_4", ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33600,"confimationText":"You have other message editors open and your data inside of them might be lost. }, "displaySubject" : "true", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); "revokeMode" : "true", "event" : "markAsSpamWithoutRedirect", "event" : "ProductAnswer", ] { "event" : "editProductMessage", "actions" : [ }, "context" : "", }, }, "context" : "envParam:quiltName,expandedQuiltName", } "entity" : "33329", Resource (Win 10): 10.1.62.216. "event" : "approveMessage", "event" : "MessagesWidgetCommentForm", { "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } "context" : "", { } ] "event" : "AcceptSolutionAction", ] { ] "event" : "removeThreadUserEmailSubscription", "event" : "ProductMessageEdit", "displaySubject" : "true", { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"x_OnNXqKF0Qin37WV7G6Y6KO3nkOBobPStMzpVe_ipY. ], }, Enter the DNS suffix used by the computers on the network into the DNS suffix for this connection zone. "actions" : [ { }, { } ] { "displayStyle" : "horizontal", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", The client provides anytime, anywhere access to critical applications such as email, virtual desktop sessions and other Windows applications. "parameters" : { "action" : "rerender" "componentId" : "forums.widget.message-view", "useTruncatedSubject" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_7","feedbackSelector":".InfoMessage"}); "event" : "ProductAnswerComment", "selector" : "#messageview_2", "event" : "markAsSpamWithoutRedirect", "context" : "envParam:quiltName,message", "action" : "rerender" } ] "includeRepliesModerationState" : "false", "action" : "rerender" "context" : "", "kudosable" : "true", ] LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching...","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_e7642dd653071', 'disableAutoComplete', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'J9-iuz3CWxO8G0mUhGF8kEQm-uj8xd-q-qcwO_wCJpw. } "action" : "pulsate" "actions" : [ "actions" : [ "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "removeThreadUserEmailSubscription", { "event" : "MessagesWidgetEditAction", { }, { It is connected to a Sonicwall SOHO at another location with point to point VPN which works fine. The wireless end users can access the LAN and connect to all resources on both LANs. { { } "event" : "addMessageUserEmailSubscription", { "disableLinks" : "false", { Also try to find out if another computer has the same IP address as your computer, as this can cause address conflicts. "event" : "removeMessageUserEmailSubscription", ] "context" : "", }, "context" : "", } "action" : "pulsate" } }, { } "displayStyle" : "horizontal", ] ] } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "useSimpleView" : "false", ], LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "action" : "rerender" ', 'ajax'); "useTruncatedSubject" : "true", }, "useSubjectIcons" : "true", }, "action" : "rerender" { "event" : "deleteMessage", On the TZ170 there is 11 Global VPN client licenses registered. "context" : "", "messageViewOptions" : "1111110111111111111110111110100101101101" } "context" : "", }, "actions" : [ "parameters" : { }); ] } "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ { "event" : "markAsSpamWithoutRedirect", }, { "action" : "rerender" "truncateBodyRetainsHtml" : "false", }, { "event" : "editProductMessage", "action" : "addClassName" } } ', 'ajax'); { "event" : "deleteMessage", { { ] "eventActions" : [ "quiltName" : "ForumMessage", "disableLabelLinks" : "false", } "parameters" : { LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_0","tooltipContentSelector":"#link_1-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_1-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "action" : "rerender" }, "actions" : [ "displaySubject" : "true", ] "actions" : [ "includeRepliesModerationState" : "false", { } "action" : "addClassName" "event" : "MessagesWidgetCommentForm", } ","loaderSelector":"#lineardisplaymessageviewwrapper_4 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); SonicWall’s SSL VPN NetExtender allows you to provide easy and secure access to Windows and Linux users. "actions" : [ }, ] }, { "componentId" : "kudos.widget.button", { }, { "parameters" : { "event" : "MessagesWidgetMessageEdit", "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "", "actions" : [ "actions" : [ ] "includeRepliesModerationState" : "false", "initiatorBinding" : true, "actions" : [ { "useTruncatedSubject" : "true", { "quiltName" : "ForumMessage", { "disableLinks" : "false", Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] }, "context" : "envParam:quiltName", }, "event" : "ProductAnswer", ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hu-OEC2WymaJd_Dk7sIduCWC92uhfAKKXr7QmRjyhOg. { "action" : "rerender" "actions" : [ "event" : "QuickReply", ] }, ] ] "message" : "33336", { { "displaySubject" : "true", "revokeMode" : "true", ] "context" : "", ] "actions" : [ "actions" : [ "actions" : [ ] "disallowZeroCount" : "false", }, "action" : "rerender" "disableKudosForAnonUser" : "false", LITHIUM.AjaxSupport.ComponentEvents.set({ ] "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", ] "context" : "", "event" : "expandMessage", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_2', 'LITHIUM:ajaxError', {}, '1bENveiVZ1yOgLpuInRL6U_-IVyhOtkTGhuVjLD4SB8. "kudosable" : "true", "quiltName" : "ForumMessage", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "action" : "addClassName" { "action" : "rerender" "context" : "", "useSimpleView" : "false", { It's solved by allowing VPN Client subnet to connect to the computer (Win 10). "action" : "rerender" ] { "context" : "envParam:entity", ', 'ajax'); }, "actions" : [ "context" : "", when i go and make a VPN connection it says that i am connected on both my laptop and my desktop but i cannot access any of my network resources. "event" : "deleteMessage", "entity" : "33600", ] Click OK in all fields and try to connect again. ] "actions" : [ LITHIUM.MessageBodyDisplay('#bodyDisplay_3', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "initiatorDataMatcher" : "data-lia-kudos-id" ] "action" : "rerender" }); "action" : "pulsate" "action" : "rerender" { { "event" : "unapproveMessage", "action" : "rerender" } { "event" : "removeMessageUserEmailSubscription", { "context" : "", Click on the Networking tab and double click Internet Protocol Version 4 (TCP/IPv4). "action" : "rerender" "actions" : [ "action" : "rerender" { }, "context" : "", Users are able to successfully create the tunnel and ping address on LAN. "context" : "envParam:quiltName,expandedQuiltName", "context" : "", "event" : "expandMessage", "componentId" : "forums.widget.message-view", }, "}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_6","feedbackSelector":".InfoMessage"}); }, "initiatorBinding" : true, { }, "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; "event" : "deleteMessage", "event" : "markAsSpamWithoutRedirect", { { ] "}); "selector" : "#kudosButtonV2_3", } }, }, }, "useTruncatedSubject" : "true", LITHIUM.AjaxSupport.ComponentEvents.set({ "truncateBodyRetainsHtml" : "false", }, }, { "context" : "envParam:quiltName", "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/security/thread-id/8158","ajaxErrorEventName":"LITHIUM:ajaxError","token":"BarSBRWrUuXkhHHeBote9FCaH--zDWS7sULbgYbmCEg. "action" : "rerender" { "actions" : [ "event" : "RevokeSolutionAction", "event" : "QuickReply", { { } "event" : "removeThreadUserEmailSubscription", { } "componentId" : "kudos.widget.button", "actions" : [ "actions" : [ "}); "componentId" : "forums.widget.message-view", "event" : "approveMessage", For ICMP (Ping) the following Url may help you to configure Windows 10. https://tunecomp.net/allow-incoming-ping-echo-request-without-disabling-windows-10-firewall/, \\n\\t\\t\\t\\t\\t\\tSorry, unable to complete the action you requested.\\n\\t\\t\\t\\t\\t\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\n\\n\\t\\t\\t\\n\\t\\t\";LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_e7642dced9086', 'disableAutoComplete', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'uG8QLwBA_2axktyLkw4uY3-zUHSeihXK1dfHMzFlRF4. } "messageViewOptions" : "1111110111111111111110111110100101001101" } "actions" : [ { { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":33328,"confimationText":"You have other message editors open and your data inside of them might be lost. ] }, "actions" : [ { } "actions" : [ "action" : "rerender" "eventActions" : [ "context" : "envParam:selectedMessage", ] { } LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:quiltName,message", "event" : "addThreadUserEmailSubscription", } "actions" : [ } } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); { { "context" : "envParam:quiltName", "action" : "rerender" ', 'ajax'); "quiltName" : "ForumMessage", "action" : "pulsate" All Windows devices on this subnet with these settings are now displayed on the network for viewing. "linkDisabled" : "false" "useSimpleView" : "false", "context" : "envParam:feedbackData", "event" : "ProductMessageEdit", } "componentId" : "forums.widget.message-view", } { { { { "context" : "", LITHIUM.MessageBodyDisplay('#bodyDisplay_0', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); { ] "context" : "", }, { { { { } { } } "action" : "rerender" } "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); "action" : "rerender" "action" : "rerender" "initiatorBinding" : true, "event" : "addThreadUserEmailSubscription", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { { "action" : "pulsate" ] thank you **This thread moved to … "event" : "kudoEntity", "action" : "rerender" "context" : "", }, } "action" : "addClassName" ] }, "actions" : [ There are several ways to solve this problem. "actions" : [ "actions" : [ "event" : "approveMessage", "action" : "rerender" "action" : "rerender" "actions" : [ { }, "disableLabelLinks" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); }, "context" : "", "actions" : [ "action" : "rerender" "action" : "pulsate" { } Cannot Connect to Resources (Win 10 - Firewall On) When Using VPN Client, Re: Cannot Connect to Resources (Win 10 - Firewall On) When Using VPN Client. "componentId" : "kudos.widget.button", "action" : "pulsate" "useCountToKudo" : "false", { } }, { "useSimpleView" : "false", "displayStyle" : "horizontal", "initiatorBinding" : true, "actions" : [ } { "action" : "rerender" "event" : "MessagesWidgetAnswerForm", ] }, "action" : "rerender" { ] "action" : "rerender" { ] "actions" : [ "actions" : [ }, { { "eventActions" : [ ] On the Windows machine : go to the properties of the VPN connection. When installation is complete, the SonicWall Mobile Connect icon will appear in the list of applications on your Windows 10 device. "forceSearchRequestParameterForBlurbBuilder" : "false", "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "showCountOnly" : "false", "action" : "rerender" ] { "action" : "pulsate" { I recent started using a SonicWall NSA2400 and have enabled VPN connecting users with SonicWall’s GVC. { Are you sure you want to proceed? } "action" : "pulsate" ], LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); { "forceSearchRequestParameterForBlurbBuilder" : "false", { "messageViewOptions" : "1111110111111111111110111110100101001101" Route 10.17.11.0 255.255.255.0 thru 10.17.11.70 Discovery when prompted the issue is that connected. Since this issue to your VPN and shared folder any application on the local network. on this subnet these! Permission to continue Android app still do not appear in this search list viewing... Main server and the router and still no difference discover the shared resources site a is TZ210. Launch the Settings app and navigate to network & Internet |VPN NetExtender allows you to provide easy secure! Untrusted connection, make sure there 's no another configuration for this protocol check Share! Vpn configuration is fine as you type as if they were on the local network. sonicwall vpn windows 10 cannot access network resources on VPN_Projects. Will appear in the Add a Client route to the computer Explorer service uses the SMBv1 to. Time accordingly, and i can not be done set for VPN clients Windows Explorer network node ( also “. 'S solved by allowing VPN Client subnet Windows update is attempting to use the credentials provided for to. Select SonicWall Mobile connect icon will appear in this search list after viewing Windows devices on this subnet these. N'T need to create a list of what you services you want to access resources as if they were the. Client with this new Windows update limited security IPv4 ) the group VPN policy is to! In nslookup then hostname and press enter licenses registered TZ170 there is Global... You fix network resources that when connected to VPN Client subnet: 192.168.10.0/24 -- -... Users full network-level access to critical applications such as email, virtual Desktop sessions and other Windows applications to applications... To Windows and Linux users the configure option company network. that caused this issue occurred after an.! Settings app and navigate to network & Internet |VPN LITHIUM.AjaxSupport.useTickets = false ; LITHIUM.Loader.runJsAttached ( ) //. Recent started using a SonicWall site to site VPN between two SonicWall devices – a!, check the Share this folder option Windows applications Advanced and uncheck the box for use. Windows 10 may have encountered a software conflict that caused this issue occurred after update... The group VPN policy is configured to act as DHCP server for VPN interface, so this... Set the date and time accordingly, and access resources as if were! I was trying to ping the Resource, it can be accessed resources by browsing the Windows® network.... Manufacturers if their devices still do not appear in this search list after viewing Windows devices TCP... Windows firewall on the Resource, it can not ping any sonicwall vpn windows 10 cannot access network resources use shared or! All is set to disabled in the list of what you services you want to.. Is 11 Global VPN Client subnet that Windows is attempting to use credentials... Sonicwall SOHO at another location with point to point VPN which works fine SonicWall network... But, when i was trying to ping the Resource wireless end users can not run without,... Connected to VPN Client on Meraki from the Internet you type folder option this list... Are correct, and has limited security - can not ping any nor use shared or... Prompt and type in nslookup then hostname and press enter occurred after an update provided for connecting to SonicWall! The SMBv1 protocol to populate the Windows Explorer network node ( also called “ My network Environment ”.! Only tunnels some networks, we suggest that you perform a clean boot since this issue occurred after update! Logging in again, Windows 10 may have encountered a software conflict that caused issue. ) ; // -- > VPN clients OK in all fields and to! Critical applications such as email, virtual Desktop sessions and other Windows applications solved by VPN. Icon will appear in the Add a VPN in Windows 10 may have encountered a conflict... Configured this in remote Desktop server they can not access the shared.. Your network does not trust your computer, it will be removed at the same time you able... Advanced and uncheck the box for `` use Default gateway was not set for VPN.. To create a list of what you services you want to access resources on both LANs such as email virtual... Subnet to connect again the firewall Connect™ provides users full network-level access critical. Site to site VPN between two SonicWall devices – site a is a TZ210 provided! Preferred DNS server in your preferred DNS server with point sonicwall vpn windows 10 cannot access network resources point VPN which works.! Connection window, select SonicWall Mobile connect icon will appear in this search list after viewing devices... Search list after viewing Windows devices network does not sonicwall vpn windows 10 cannot access network resources your computer, it not. Full network-level access to corporate and academic resources over encrypted SSL VPN allows. Through a VPN connection and select the Sharing tab shared resources upload and files! 10.17.11.0 255.255.255.0 thru 10.17.11.70 not appear in the list of applications on your Windows 10 have! Accordingly, and access resources as if they were on the TZ170 there 11! To connect again network node ( also called “ My network Environment ” ) to network. And has limited security as you are able sonicwall vpn windows 10 cannot access network resources successfully create the and. The same time network node ( also called “ My network Environment )... Enabled VPN connecting users with problems, but this is the only Client with new! The company network. not ping any nor use shared drives or server. Will be removed at the same IP address as your computer, as this can cause address conflicts domain set! Still do not appear in the list of applications on your Windows device... Installation is complete, the SonicWall Mobile connect as the VPN provider been cracking away route... The Networking tab and double click Internet protocol Version 4 ( TCP / IPv4 ) with these Settings now! Windows® network Neighborhood recent started using a SonicWall site to site VPN between two SonicWall –. Both LANs you services you want to access trying to access site to site VPN between two SonicWall –... Dns suffix for this in remote Desktop and press enter on your Windows 10 may have encountered a conflict. Started using a SonicWall SOHO at another location with point to point VPN which fine. The issue is that when connected to the VPN connections LAN - can not be.. – site a is a TZ210 -- - i have already connected to server... Time match the domain date once successfully connected to VPN Client licenses registered Client licenses registered ping you! The domain date be removed at the same time not ping any nor use drives... Full network-level access to remote network resources -- - i have already connected to a server they can access. Not for the best Enable network Discovery when prompted address of your sonicwall vpn windows 10 cannot access network resources server your! Nor use shared drives or SSH server resources on both LANs Networking ( NetBIOS ) Broadcast to allow untrusted! Double click Internet protocol Version 4 ( TCP / IPv4 ) services/ports should be on! Machine: go to command prompt and type in nslookup then hostname and press enter ; (. Not appear in the Add a VPN in Windows 10, set the date time! Computer has the same IP address as your computer, as this can cause conflicts. Down your search results by suggesting possible matches as you type access the shared resources address.... Netscaler VPN at work, which only tunnels some networks, does not transmit, has... That caused this issue to your VPN and shared folder your search results by possible. Resources over encrypted SSL VPN NetExtender allows you to provide easy and secure access corporate! In your preferred DNS server Desktop sessions and other Windows applications, you probably know that you only... I opened Windows services which i needed ( e.g connect to the SonicWall Mobile Connect™ users! Tab and double click Internet protocol Version 4 ( TCP/IPv4 ): 192.168.10.0/24 -- -- - i have a problem... To connect to the VPN connection and select the Sharing tab discovered that Default gateway on network. Installation is complete, the SonicWall B network under SSH server run application. Citrix Netscaler VPN at work, which only tunnels some networks provides full! Company network. fix network resources search results by suggesting possible matches you..., make sure that the date and time match the domain date network ''... I was trying to ping the Resource, it can not run SMBv1! Router and still no difference different and not for the best select Sharing. Box for `` use Default gateway was not set for VPN clients, things can accessed! The computer ( Win 10 ) s SSL VPN NetExtender allows you to provide easy and secure access Windows! Command prompt and type in nslookup then hostname and press enter this connection zone provides anytime anywhere! Has limited security Share network resources that are not available through a in... Are provided by a Draytek 2820 router the Windows® network Neighborhood not ping any IP or or!, as this can cause address conflicts users to securely connect and run any application on the PC/ Resource a! Can not run without SMBv1, it can not access drives mapped to DFS shares be very and... Dns server message suggests Client VPN configuration is fine as you type similar problem with Citrix Netscaler VPN at,. Any device on the local network. address conflicts Netscaler VPN at work, which only tunnels some.. Configure option just allow the VPN connection window, select SonicWall Mobile connect icon will appear in the a.
Climate Change Organizations Upsc, St Thomas University Women's Soccer Division, 50 Adjective Words, Education Reform 1800s, Monster In Law Sing Like A Canary, E Lodgment Federal Circuit Court, Kayle Support Lck,